Lineage for d6ptta_ (6ptt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366998Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2366999Protein Cytochrome c oxidase [49544] (4 species)
  7. 2367087Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)
  8. 3077097Domain d6ptta_: 6ptt A: [377159]
    automated match to d2llna_
    complexed with cua

Details for d6ptta_

PDB Entry: 6ptt (more details), 1.84 Å

PDB Description: soluble model of arabidopsis thaliana cua (tt3lat)
PDB Compounds: (A:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6ptta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ptta_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lervdpttvrqegpwadpaqavvqtgpnqytvyvlahqwyyqpnpievpqgaeivfkits
advlhgfhvegtninvevlpgevstvrytfkrpgeyriicseicgtnhafmfgtivvke

SCOPe Domain Coordinates for d6ptta_:

Click to download the PDB-style file with coordinates for d6ptta_.
(The format of our PDB-style files is described here.)

Timeline for d6ptta_:

  • d6ptta_ is new in SCOPe 2.07-stable