SCOPe 2.08: Domain d6plkf_: 6plk F:

Lineage for d6plkf_ (6plk F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId:2043570] [377146] (2 PDB entries)

8. Domain d6plkf_: 6plk F: [377148]
   Other proteins in same PDB: d6plkh_, d6plki_, d6plkl1, d6plkl2, d6plkm1, d6plkm2
   automated match to d5omza_

Details for d6plkf_

PDB Entry: 6plk, 2.3 Å

PDB Description: crystal structure of zikv-116 fab in complex with zikv envelope diii

PDB Compounds: (F:) Env

SCOPe Domain Sequences for d6plkf_:

Sequence; same for both SEQRES and ATOM records:

>d6plkf_ b.1.18.4 (F:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrsgs

Timeline for d6plkf_:

• d6plkf_ first appeared in SCOPe 2.07