Lineage for d6iseb_ (6ise B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983373Species Cryptococcus neoformans [TaxId:1230076] [376374] (6 PDB entries)
  8. 2983380Domain d6iseb_: 6ise B: [377063]
    automated match to d3at3a_
    complexed with anp, edo, so4

Details for d6iseb_

PDB Entry: 6ise (more details), 2.8 Å

PDB Description: crystal structure of amppnp bound ck2 alpha from c. neoformans
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d6iseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iseb_ d.144.1.7 (B:) automated matches {Cryptococcus neoformans [TaxId: 1230076]}
rsvarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlptdskc
ivkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntefktly
pkfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaefyhpg
teynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadqlvki
akvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfldkll
rydhqerltaeeakehpyfepvrqaaa

SCOPe Domain Coordinates for d6iseb_:

Click to download the PDB-style file with coordinates for d6iseb_.
(The format of our PDB-style files is described here.)

Timeline for d6iseb_: