Lineage for d1fumn2 (1fum N:1-105)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77994Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)
  6. 78014Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species)
  7. 78015Species Escherichia coli [TaxId:562] [54326] (1 PDB entry)
  8. 78017Domain d1fumn2: 1fum N:1-105 [37706]
    Other proteins in same PDB: d1fuma1, d1fuma2, d1fuma3, d1fumb1, d1fumc_, d1fumd_, d1fumm1, d1fumm2, d1fumm3, d1fumn1, d1fumo_, d1fump_

Details for d1fumn2

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fumn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fumn2 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOP Domain Coordinates for d1fumn2:

Click to download the PDB-style file with coordinates for d1fumn2.
(The format of our PDB-style files is described here.)

Timeline for d1fumn2: