Lineage for d6issg_ (6iss G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720358Species Phanerochaete chrysosporium [TaxId:273507] [362699] (2 PDB entries)
  8. 2720360Domain d6issg_: 6iss G: [377032]
    automated match to d1b80a_
    complexed with ca, hem; mutant

Details for d6issg_

PDB Entry: 6iss (more details), 1.53 Å

PDB Description: lignin peroxidase h8 triple mutant s49c/a67c/h239
PDB Compounds: (G:) Ligninase H8

SCOPe Domain Sequences for d6issg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6issg_ a.93.1.1 (G:) automated matches {Phanerochaete chrysosporium [TaxId: 273507]}
ekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdciaispame
aqgkfggggcdgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagaval
sncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsahs
vaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqs
detiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipg
nlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga

SCOPe Domain Coordinates for d6issg_:

Click to download the PDB-style file with coordinates for d6issg_.
(The format of our PDB-style files is described here.)

Timeline for d6issg_: