Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d6hgul1: 6hgu L:1-112 [377000] Other proteins in same PDB: d6hgub2, d6hgul2 automated match to d1t66c1 complexed with epe, gol |
PDB Entry: 6hgu (more details), 1.5 Å
SCOPe Domain Sequences for d6hgul1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hgul1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqnthvpltfgagtklelk
Timeline for d6hgul1:
View in 3D Domains from other chains: (mouse over for more information) d6hgua_, d6hgub1, d6hgub2, d6hguh_ |