Lineage for d1ffva2 (1ffv A:3-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30566Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)
  6. 30572Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 30573Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)
  8. 30574Domain d1ffva2: 1ffv A:3-81 [37700]
    Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2

Details for d1ffva2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava}
kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
thlavqcdgsevltvegla

SCOP Domain Coordinates for d1ffva2:

Click to download the PDB-style file with coordinates for d1ffva2.
(The format of our PDB-style files is described here.)

Timeline for d1ffva2: