Lineage for d1qj2g2 (1qj2 G:3-81)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77994Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)
  6. 78000Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 78006Species Pseudomonas carboxydovorans [54321] (1 PDB entry)
  8. 78008Domain d1qj2g2: 1qj2 G:3-81 [37699]
    Other proteins in same PDB: d1qj2a1, d1qj2b1, d1qj2b2, d1qj2c1, d1qj2c2, d1qj2g1, d1qj2h1, d1qj2h2, d1qj2i1, d1qj2i2

Details for d1qj2g2

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2g2 d.15.4.2 (G:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Pseudomonas carboxydovorans}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOP Domain Coordinates for d1qj2g2:

Click to download the PDB-style file with coordinates for d1qj2g2.
(The format of our PDB-style files is described here.)

Timeline for d1qj2g2: