Lineage for d1dgja2 (1dgj A:1-80)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2933995Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 2933996Species Desulfovibrio desulfuricans [TaxId:876] [54317] (1 PDB entry)
  8. 2933997Domain d1dgja2: 1dgj A:1-80 [37694]
    Other proteins in same PDB: d1dgja1, d1dgja3, d1dgja4
    complexed with 2mo, fes, mcn

Details for d1dgja2

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1dgja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]}
metktlivngmarrllvspndllvdvlrsqlqltsvkvgcgkgqcgactvildgkvvrac
iikmsrvaenasvttlegig

SCOPe Domain Coordinates for d1dgja2:

Click to download the PDB-style file with coordinates for d1dgja2.
(The format of our PDB-style files is described here.)

Timeline for d1dgja2: