SCOPe 2.08: Domain d6rpsl2: 6rps L:108-213

Lineage for d6rpsl2 (6rps L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6rpsl2: 6rps L:108-213 [376939]
   Other proteins in same PDB: d6rpsa1, d6rpsa2, d6rpsb1, d6rpsb2, d6rpsh_, d6rpsl1, d6rpsm1, d6rpsn_
   automated match to d1um5l2
   complexed with act, cd, cl, so4, zn

Details for d6rpsl2

PDB Entry: 6rps, 2.79 Å

PDB Description: x-ray crystal structure of carbonic anhydrase xii complexed with a theranostic monoclonal antibody fragment

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6rpsl2:

Sequence; same for both SEQRES and ATOM records:

>d6rpsl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6rpsl2:

• d6rpsl2 first appeared in SCOPe 2.07