Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries) |
Domain d6u7gb2: 6u7g B:288-548 [376904] Other proteins in same PDB: d6u7ga1, d6u7ga3, d6u7ga4, d6u7gb1, d6u7gb3, d6u7gb4 automated match to d4fyta2 complexed with nag, zn |
PDB Entry: 6u7g (more details), 2.35 Å
SCOPe Domain Sequences for d6u7gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7gb2 d.92.1.0 (B:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]} dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn rsiqlpttvrdimnrwtlqmg
Timeline for d6u7gb2:
View in 3D Domains from other chains: (mouse over for more information) d6u7ga1, d6u7ga2, d6u7ga3, d6u7ga4 |