Lineage for d1cjea_ (1cje A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189382Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 189383Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 189446Protein Adrenodoxin [54310] (1 species)
  7. 189447Species Cow (Bos taurus) [TaxId:9913] [54311] (5 PDB entries)
  8. 189452Domain d1cjea_: 1cje A: [37686]

Details for d1cjea_

PDB Entry: 1cje (more details), 2.5 Å

PDB Description: adrenodoxin from bovine

SCOP Domain Sequences for d1cjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjea_ d.15.4.1 (A:) Adrenodoxin {Cow (Bos taurus)}
kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdav

SCOP Domain Coordinates for d1cjea_:

Click to download the PDB-style file with coordinates for d1cjea_.
(The format of our PDB-style files is described here.)

Timeline for d1cjea_: