Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6o9ca2: 6o9c A:182-278 [376827] Other proteins in same PDB: d6o9ca1, d6o9ca3, d6o9cb_ automated match to d1a9ea1 complexed with mes, peg, so4; mutant |
PDB Entry: 6o9c (more details), 2.45 Å
SCOPe Domain Sequences for d6o9ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o9ca2 b.1.1.0 (A:182-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpkpltlrwelss
Timeline for d6o9ca2: