SCOP 1.55: Domain d1gaqb_: 1gaq B:

Lineage for d1gaqb_ (1gaq B:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (11 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (1 PDB entry)

8. Domain d1gaqb_: 1gaq B: [37679]
   Other proteins in same PDB: d1gaqa1, d1gaqa2, d1gaqc1, d1gaqc2

Details for d1gaqb_

PDB Entry: 1gaq, 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqb_:

Sequence; same for both SEQRES and ATOM records:

>d1gaqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays)}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeeltga

Timeline for d1gaqb_:

• d1gaqb_ appears in SCOP 1.57
  
• d1gaqb_ appears in the current release, SCOPe 2.08