Lineage for d1gaqb_ (1gaq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933818Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)
  8. 2933826Domain d1gaqb_: 1gaq B: [37679]
    Other proteins in same PDB: d1gaqa1, d1gaqa2, d1gaqc1, d1gaqc2
    complexed with fad, fes

Details for d1gaqb_

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1gaqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeeltga

SCOPe Domain Coordinates for d1gaqb_:

Click to download the PDB-style file with coordinates for d1gaqb_.
(The format of our PDB-style files is described here.)

Timeline for d1gaqb_: