Lineage for d1a70__ (1a70 -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) Protein 2Fe-2S ferredoxin [54294] (16 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [54304] (1 PDB entry) 
Domain d1a70__: 1a70 - [37678]
Details for d1a70__
PDB Entry: 1a70 (more details), 1.7 Å
PDB Description: spinach ferredoxin
SCOP Domain Sequences for d1a70__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a70__ d.15.4.1 (-) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea)}
aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqdd
qsfldddqidegwvltcaaypvsdvtiethkkeelta
SCOP Domain Coordinates for d1a70__:
Click to download the PDB-style file with coordinates for d1a70__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a70__:
- d1a70__ first appeared (with stable ids) in SCOP 1.55
- d1a70__ appears in SCOP 1.59
- d1a70__ appears in SCOP 1.63
- d1a70__ appears in the current release, SCOPe 2.08, called d1a70a_
View in 3D