Lineage for d1pfd__ (1pfd -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) Protein 2Fe-2S ferredoxin [54294] (16 species) 
Species Parsley (Petroselinum crispum) [TaxId:4043] [54303] (1 PDB entry) 
Domain d1pfd__: 1pfd - [37677]
Details for d1pfd__
PDB Entry: 1pfd (more details)
PDB Description: the solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
SCOP Domain Sequences for d1pfd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Parsley (Petroselinum crispum)}
atynvklitpdgevefkcdddvyvldqaeeegidipyscragscsscagkvvsgsidqsd
qsflddeqmdagyvltchayptsdvviethkeeeiv
SCOP Domain Coordinates for d1pfd__:
Click to download the PDB-style file with coordinates for d1pfd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pfd__:
- d1pfd__ first appeared (with stable ids) in SCOP 1.55
- d1pfd__ appears in SCOP 1.59
- d1pfd__ appears in SCOP 1.63
- d1pfd__ appears in the current release, SCOPe 2.08, called d1pfda_
View in 3D