Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (19 species) |
Species Equisetum arvense [TaxId:3258] [54301] (2 PDB entries) Uniprot P00237 # isoform II |
Domain d1frrb_: 1frr B: [37675] complexed with fes |
PDB Entry: 1frr (more details), 1.8 Å
SCOPe Domain Sequences for d1frrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frrb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} ayktvlktpsgeftldvpegttildaaeeagydlpfscragacssclgkvvsgsvdeseg sflddgqmeegfvltciaipesdlviethkeeelf
Timeline for d1frrb_: