Lineage for d1frrb_ (1frr B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30503Protein 2Fe-2S ferredoxin [54294] (11 species)
  7. 30530Species Equisetum arvense [TaxId:3258] [54301] (1 PDB entry)
  8. 30532Domain d1frrb_: 1frr B: [37675]

Details for d1frrb_

PDB Entry: 1frr (more details), 1.8 Å

PDB Description: crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution

SCOP Domain Sequences for d1frrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frrb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Equisetum arvense}
ayktvlktpsgeftldvpegttildaaeeagydlpfscragacssclgkvvsgsvdeseg
sflddgqmeegfvltciaipesdlviethkeeelf

SCOP Domain Coordinates for d1frrb_:

Click to download the PDB-style file with coordinates for d1frrb_.
(The format of our PDB-style files is described here.)

Timeline for d1frrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1frra_