Lineage for d1awd__ (1awd -)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) Protein 2Fe-2S ferredoxin [54294] (16 species) 
Species Chlorella fusca [TaxId:3073] [54300] (1 PDB entry) 
Domain d1awd__: 1awd - [37673]
complexed with fes
Details for d1awd__
PDB Entry: 1awd (more details), 1.4 Å
PDB Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca
SCOP Domain Sequences for d1awd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Chlorella fusca}
ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
flddaqmgkgfvltcvayptsdvtilthqeaaly
SCOP Domain Coordinates for d1awd__:
Click to download the PDB-style file with coordinates for d1awd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awd__:
- d1awd__ first appeared (with stable ids) in SCOP 1.55
- d1awd__ appears in SCOP 1.61
- d1awd__ appears in SCOP 1.65
- d1awd__ appears in the current release, SCOPe 2.08, called d1awda_
View in 3D