Lineage for d1awd__ (1awd -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189382Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 189383Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 189384Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 189390Species Chlorella fusca [TaxId:3073] [54300] (1 PDB entry)
  8. 189391Domain d1awd__: 1awd - [37673]

Details for d1awd__

PDB Entry: 1awd (more details), 1.4 Å

PDB Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca

SCOP Domain Sequences for d1awd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Chlorella fusca}
ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
flddaqmgkgfvltcvayptsdvtilthqeaaly

SCOP Domain Coordinates for d1awd__:

Click to download the PDB-style file with coordinates for d1awd__.
(The format of our PDB-style files is described here.)

Timeline for d1awd__: