SCOPe 2.05: Domain d1fxib_: 1fxi B:

Lineage for d1fxib_ (1fxi B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Aphanothece sacrum [TaxId:1122] [54297] (1 PDB entry)

8. Domain d1fxib_: 1fxi B: [37665]
   complexed with fes

Details for d1fxib_

PDB Entry: 1fxi, 2.2 Å

PDB Description: structure of the [2fe-2s] ferredoxin i from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution

PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1fxib_:

Sequence; same for both SEQRES and ATOM records:

>d1fxib_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

Timeline for d1fxib_:

• d1fxib_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxib_ appears in SCOPe 2.04
  
• d1fxib_ appears in SCOPe 2.06
  
• d1fxib_ appears in the current release, SCOPe 2.08