Lineage for d6u2xd_ (6u2x D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (58 species)
    not a true protein
  7. 2482355Species Human (Homo sapiens) [TaxId:9606] [225691] (31 PDB entries)
  8. 3076584Domain d6u2xd_: 6u2x D: [376646]
    automated match to d2jg7a_
    complexed with nad; mutant

Details for d6u2xd_

PDB Entry: 6u2x (more details), 2.15 Å

PDB Description: structure of aldh7a1 mutant e399g complexed with nad
PDB Compounds: (D:) Alpha-aminoadipic semialdehyde dehydrogenase

SCOPe Domain Sequences for d6u2xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u2xd_ c.82.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
dawkqymrrstctinyskdlplaqgikfq

SCOPe Domain Coordinates for d6u2xd_:

Click to download the PDB-style file with coordinates for d6u2xd_.
(The format of our PDB-style files is described here.)

Timeline for d6u2xd_:

  • d6u2xd_ is new in SCOPe 2.07-stable