Lineage for d1fxab_ (1fxa B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131041Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins)
  6. 131042Protein 2Fe-2S ferredoxin [54294] (12 species)
  7. 131050Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 131067Domain d1fxab_: 1fxa B: [37661]

Details for d1fxab_

PDB Entry: 1fxa (more details), 2.5 Å

PDB Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120

SCOP Domain Sequences for d1fxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxab_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1fxab_:

Click to download the PDB-style file with coordinates for d1fxab_.
(The format of our PDB-style files is described here.)

Timeline for d1fxab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fxaa_