Lineage for d1qogb_ (1qog B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131041Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins)
  6. 131042Protein 2Fe-2S ferredoxin [54294] (12 species)
  7. 131050Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 131065Domain d1qogb_: 1qog B: [37658]

Details for d1qogb_

PDB Entry: 1qog (more details), 1.8 Å

PDB Description: ferredoxin mutation s47a

SCOP Domain Sequences for d1qogb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qogb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacatcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1qogb_:

Click to download the PDB-style file with coordinates for d1qogb_.
(The format of our PDB-style files is described here.)

Timeline for d1qogb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qoga_