Lineage for d6pcoa_ (6pco A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694628Species Bordetella bronchiseptica [TaxId:518] [376530] (1 PDB entry)
  8. 2694629Domain d6pcoa_: 6pco A: [376537]
    automated match to d1jgsa_
    complexed with bu1

Details for d6pcoa_

PDB Entry: 6pco (more details), 2.75 Å

PDB Description: mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid
PDB Compounds: (A:) MarR-family transcriptional regulator

SCOPe Domain Sequences for d6pcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcoa_ a.4.5.0 (A:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
gpyhfseqvghllrrayqrhvaifqqtipdskltaaqfvvlcalrdqgacslvdvvkata
idqatvrgvierlkarkllavshdpadrrkvlvtltpdgralveemvpfaeqitqstfgg
lnpaervaivyllrkmsda

SCOPe Domain Coordinates for d6pcoa_:

Click to download the PDB-style file with coordinates for d6pcoa_.
(The format of our PDB-style files is described here.)

Timeline for d6pcoa_: