Lineage for d1qofa_ (1qof A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) 
Protein 2Fe-2S ferredoxin [54294] (19 species) Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) 
Domain d1qofa_: 1qof A: [37653]
complexed with fes, so4; mutant
Details for d1qofa_
PDB Entry: 1qof (more details), 1.8 Å
PDB Description: ferredoxin mutation q70k
PDB Compounds: (A:) ferredoxinSCOPe Domain Sequences for d1qofa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qofa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddkieagyvltcvayptsdvviqthkeedly
SCOPe Domain Coordinates for d1qofa_:
Click to download the PDB-style file with coordinates for d1qofa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qofa_:
- d1qofa_ first appeared (with stable ids) in SCOP 1.55
- d1qofa_ appears in SCOPe 2.07
View in 3D
