SCOPe 2.06: Domain d1qoaa_: 1qoa A:

Lineage for d1qoaa_ (1qoa A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1qoaa_: 1qoa A: [37649]
   complexed with fes; mutant

Details for d1qoaa_

PDB Entry: 1qoa, 1.7 Å

PDB Description: ferredoxin mutation c49s

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1qoaa_:

Sequence; same for both SEQRES and ATOM records:

>d1qoaa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstsagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

Timeline for d1qoaa_:

• d1qoaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoaa_ appears in SCOPe 2.05
  
• d1qoaa_ appears in SCOPe 2.07
  
• d1qoaa_ appears in the current release, SCOPe 2.08