SCOPe 2.08: Domain d6mypb2: 6myp B:115-247

Lineage for d6mypb2 (6myp B:115-247)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [375657] (7 PDB entries)

8. Domain d6mypb2: 6myp B:115-247 [376481]
   Other proteins in same PDB: d6mypb1, d6mypd_
   automated match to d1yq3b2
   complexed with 3pe, bct, f3s, fad, fes, hem, k, mg, oaa, peg, sf4, ttf, umq, unl

Details for d6mypb2

PDB Entry: 6myp, 2.1 Å

PDB Description: avian mitochondrial complex ii with ttfa (thenoyltrifluoroacetone) bound

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d6mypb2:

Sequence; same for both SEQRES and ATOM records:

>d6mypb2 a.1.2.1 (B:115-247) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke

Timeline for d6mypb2:

• d6mypb2 first appeared in SCOPe 2.07