Lineage for d1frd__ (1frd -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77921Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 77922Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (5 proteins)
  6. 77923Protein 2Fe-2S ferredoxin [54294] (12 species)
  7. 77926Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 77930Domain d1frd__: 1frd - [37648]

Details for d1frd__

PDB Entry: 1frd (more details), 1.7 Å

PDB Description: molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution

SCOP Domain Sequences for d1frd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
sdqiflddeqmgkgfallcvtyprsnctikthqepyla

SCOP Domain Coordinates for d1frd__:

Click to download the PDB-style file with coordinates for d1frd__.
(The format of our PDB-style files is described here.)

Timeline for d1frd__: