Lineage for d1frd__ (1frd -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) Protein 2Fe-2S ferredoxin [54294] (11 species) Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) 
Domain d1frd__: 1frd - [37648]
Details for d1frd__
PDB Entry: 1frd (more details), 1.7 Å
PDB Description: molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
SCOP Domain Sequences for d1frd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frd__ d.15.4.1 (-) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
sdqiflddeqmgkgfallcvtyprsnctikthqepyla
SCOP Domain Coordinates for d1frd__:
Click to download the PDB-style file with coordinates for d1frd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1frd__:
- d1frd__ appears in SCOP 1.57
- d1frd__ appears in the current release, SCOPe 2.08, called d1frda_
View in 3D