SCOPe 2.07: Domain d1czpb_: 1czp B:

Lineage for d1czpb_ (1czp B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1czpb_: 1czp B: [37646]
   complexed with fes

Details for d1czpb_

PDB Entry: 1czp, 1.17 Å

PDB Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a

PDB Compounds: (B:) ferredoxin I

SCOPe Domain Sequences for d1czpb_:

Sequence; same for both SEQRES and ATOM records:

>d1czpb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

Timeline for d1czpb_:

• d1czpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1czpb_ appears in SCOPe 2.06
  
• d1czpb_ appears in the current release, SCOPe 2.08