Lineage for d1f2ri_ (1f2r I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30479Superfamily d.15.2: CAD domain [54277] (1 family) (S)
  5. 30480Family d.15.2.1: CAD domain [54278] (3 proteins)
  6. 30488Protein Inhibitor of caspase-activated DNase (ICAD), N-terminal domain [54283] (1 species)
  7. 30489Species Mouse (Mus musculus) [TaxId:10090] [54284] (1 PDB entry)
  8. 30490Domain d1f2ri_: 1f2r I: [37641]
    Other proteins in same PDB: d1f2rc_

Details for d1f2ri_

PDB Entry: 1f2r (more details)

PDB Description: nmr structure of the heterodimeric complex between cad domains of cad and icad

SCOP Domain Sequences for d1f2ri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ri_ d.15.2.1 (I:) Inhibitor of caspase-activated DNase (ICAD), N-terminal domain {Mouse (Mus musculus)}
melsrgasapdpddvrplkpcllrrnhsrdqhgvaassleelrskacellaidksltpit
lvlaedgtivddddyflclpsntkfvalacnekwtyndsd

SCOP Domain Coordinates for d1f2ri_:

Click to download the PDB-style file with coordinates for d1f2ri_.
(The format of our PDB-style files is described here.)

Timeline for d1f2ri_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f2rc_