Lineage for d1c9fa_ (1c9f A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933607Family d.15.2.1: CAD domain [54278] (3 proteins)
  6. 2933608Protein Caspase-activated DNase (CAD), DFF40, N-terminal domain [54281] (2 species)
  7. 2933611Species Mouse (Mus musculus) [TaxId:10090] [54282] (2 PDB entries)
  8. 2933612Domain d1c9fa_: 1c9f A: [37639]

Details for d1c9fa_

PDB Entry: 1c9f (more details)

PDB Description: nmr structure of the cad domain of caspase-activated dnase
PDB Compounds: (A:) caspase-activated DNAse

SCOPe Domain Sequences for d1c9fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9fa_ d.15.2.1 (A:) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
dcfpglpndaelllltagetwhgyvsd

SCOPe Domain Coordinates for d1c9fa_:

Click to download the PDB-style file with coordinates for d1c9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c9fa_: