SCOPe 2.07: Domain d6j15b2: 6j15 B:114-216

Lineage for d6j15b2 (6j15 B:114-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6j15b2: 6j15 B:114-216 [376368]
   Other proteins in same PDB: d6j15b1, d6j15c1, d6j15c2, d6j15d1, d6j15d2, d6j15l1
   automated match to d2jell2
   complexed with fuc, man, nag

Details for d6j15b2

PDB Entry: 6j15, 2.6 Å

PDB Description: complex structure of gy-5 fab and pd-1

PDB Compounds: (B:) GY-5 light chain Fab

SCOPe Domain Sequences for d6j15b2:

Sequence; same for both SEQRES and ATOM records:

>d6j15b2 b.1.1.0 (B:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivknfnr

Timeline for d6j15b2:

• d6j15b2 is new in SCOPe 2.07-stable
  
• d6j15b2 appears in the current release, SCOPe 2.08