Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6j15b2: 6j15 B:114-216 [376368] Other proteins in same PDB: d6j15b1, d6j15c1, d6j15c2, d6j15d1, d6j15d2, d6j15l1 automated match to d2jell2 complexed with fuc, man, nag |
PDB Entry: 6j15 (more details), 2.6 Å
SCOPe Domain Sequences for d6j15b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j15b2 b.1.1.0 (B:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivknfnr
Timeline for d6j15b2: