Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries) |
Domain d6j15c1: 6j15 C:32-147 [376351] Other proteins in same PDB: d6j15a1, d6j15a2, d6j15b1, d6j15b2, d6j15c2, d6j15d2, d6j15h1, d6j15h2, d6j15l1, d6j15l2 automated match to d3bikc_ complexed with nag |
PDB Entry: 6j15 (more details), 2.6 Å
SCOPe Domain Sequences for d6j15c1:
Sequence, based on SEQRES records: (download)
>d6j15c1 b.1.1.1 (C:32-147) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq dcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvter
>d6j15c1 b.1.1.1 (C:32-147) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpecrfrvtq lpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvter
Timeline for d6j15c1: