Lineage for d6u6aa_ (6u6a A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 3067126Species Candida albicans [TaxId:237561] [367188] (3 PDB entries)
  8. 3076257Domain d6u6aa_: 6u6a A: [376319]
    automated match to d5x18a_
    complexed with q0j, so4

Details for d6u6aa_

PDB Entry: 6u6a (more details), 2.45 Å

PDB Description: crystal structure of yck2 from candida albicans in complex with kinase inhibitor gw461484a
PDB Compounds: (A:) Serine/threonine protein kinase

SCOPe Domain Sequences for d6u6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u6aa_ d.144.1.7 (A:) automated matches {Candida albicans [TaxId: 237561]}
ssvvglhykigkkigegsfgvifegtniingvpvaikfeprkteapqlrdeyrtykhlqg
cdgipnayyfgqeglhnilvidllgpsledlfdwcgrrfsvktvvqvaiqmltlveevhr
hdliyrdikpdnfligrrgatdennvhlidfgmakqyrdprtkqhipyrekkslsgtary
msinthlgreqsrrddlealghvffyflrgqlpwqglkaptnkqkyekigdkkrttpavt
lcdglpqqfaeyldsvrslpfdaeppyeeyrmlllsvlddlgqacdgdmdwmhlnggrgw
datink

SCOPe Domain Coordinates for d6u6aa_:

Click to download the PDB-style file with coordinates for d6u6aa_.
(The format of our PDB-style files is described here.)

Timeline for d6u6aa_: