SCOPe 2.08: Domain d6tzbd_: 6tzb D:

Lineage for d6tzbd_ (6tzb D:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)

8. Domain d6tzbd_: 6tzb D: [376252]
   Other proteins in same PDB: d6tzba1, d6tzba2, d6tzbc1, d6tzbc2, d6tzbe1, d6tzbe2
   automated match to d4d00d_
   complexed with gal, nag, sia

Details for d6tzbd_

PDB Entry: 6tzb, 2.24 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with 6'-slnln

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6tzbd_:

Sequence; same for both SEQRES and ATOM records:

>d6tzbd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

Timeline for d6tzbd_:

• d6tzbd_ first appeared in SCOPe 2.07