Lineage for d6l1ma_ (6l1m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2976014Species Human (Homo sapiens) [TaxId:9606] [255576] (4 PDB entries)
  8. 2976015Domain d6l1ma_: 6l1m A: [376239]
    automated match to d5brla_
    mutant

Details for d6l1ma_

PDB Entry: 6l1m (more details), 1.7 Å

PDB Description: structure of human star-related lipid transfer protein 4 mutant - lwni107-110gg
PDB Compounds: (A:) StAR-related lipid transfer protein 4

SCOPe Domain Sequences for d6l1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l1ma_ d.129.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsdvasfatklkntliqyhsieedkwrvakktkdvtvwrkpseefngylykaqgviddlv
ysiidhirpgpsrldwdslmtsldilenfeenccvmryttagqggisprefvdfsytvgy
kegllscgisldwdekrpefvrgynhpcgwfcvplkdnpnqslltgyiqtdlrgmipqsa
vdtamastltnfygdlrkal

SCOPe Domain Coordinates for d6l1ma_:

Click to download the PDB-style file with coordinates for d6l1ma_.
(The format of our PDB-style files is described here.)

Timeline for d6l1ma_: