Lineage for d1gg3a3 (1gg3 A:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853959Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 853960Protein Erythroid membrane protein 4.1R [54261] (1 species)
  7. 853961Species Human (Homo sapiens) [TaxId:9606] [54262] (1 PDB entry)
  8. 853962Domain d1gg3a3: 1gg3 A:1-81 [37615]
    Other proteins in same PDB: d1gg3a1, d1gg3a2, d1gg3b1, d1gg3b2, d1gg3c1, d1gg3c2

Details for d1gg3a3

PDB Entry: 1gg3 (more details), 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain
PDB Compounds: (A:) erythroid membrane protein 4.1r

SCOP Domain Sequences for d1gg3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]}
mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
eikkqvrgvpwnftfnvkfyp

SCOP Domain Coordinates for d1gg3a3:

Click to download the PDB-style file with coordinates for d1gg3a3.
(The format of our PDB-style files is described here.)

Timeline for d1gg3a3: