Lineage for d6u8cc1 (6u8c C:8-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1304 PDB entries)
  8. 3076087Domain d6u8cc1: 6u8c C:8-109 [376149]
    Other proteins in same PDB: d6u8ca_, d6u8cb_, d6u8cc2, d6u8cl2
    automated match to d3pgfl1

Details for d6u8cc1

PDB Entry: 6u8c (more details), 2.61 Å

PDB Description: crystal structure of an engineered ultra-high affinity fab-protein g complex
PDB Compounds: (C:) antibody light chain fab

SCOPe Domain Sequences for d6u8cc1:

Sequence, based on SEQRES records: (download)

>d6u8cc1 b.1.1.0 (C:8-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsgsr
sgtdftltisslqpedfatyycqqasltalltfgqgtkveik

Sequence, based on observed residues (ATOM records): (download)

>d6u8cc1 b.1.1.0 (C:8-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsgsr
sgtdftltisslqpedfatyycqqalltfgqgtkveik

SCOPe Domain Coordinates for d6u8cc1:

Click to download the PDB-style file with coordinates for d6u8cc1.
(The format of our PDB-style files is described here.)

Timeline for d6u8cc1: