Lineage for d6u8cb_ (6u8c B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2503891Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2503918Species Streptococcus sp., group G [TaxId:1306] [54361] (38 PDB entries)
  8. 3076078Domain d6u8cb_: 6u8c B: [376140]
    Other proteins in same PDB: d6u8cc1, d6u8cc2, d6u8cl1, d6u8cl2
    automated match to d2igga_

Details for d6u8cb_

PDB Entry: 6u8c (more details), 2.61 Å

PDB Description: crystal structure of an engineered ultra-high affinity fab-protein g complex
PDB Compounds: (B:) protein g

SCOPe Domain Sequences for d6u8cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u8cb_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
avttyklvingrtlsgyttttavdaataekvfkqyayvhevdgewtyddatktftvte

SCOPe Domain Coordinates for d6u8cb_:

Click to download the PDB-style file with coordinates for d6u8cb_.
(The format of our PDB-style files is described here.)

Timeline for d6u8cb_: