SCOPe 2.07: Domain d1eo6b_: 1eo6 B:

Lineage for d1eo6b_ (1eo6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein Golgi-associated ATPase enhancer of 16 kD, Gate-16 [54254] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54255] (1 PDB entry)

8. Domain d1eo6b_: 1eo6 B: [37610]

Details for d1eo6b_

PDB Entry: 1eo6, 1.8 Å

PDB Description: crystal structure of gate-16

PDB Compounds: (B:) golgi-associated ATPase enhancer of 16 kd

SCOPe Domain Sequences for d1eo6b_:

Sequence; same for both SEQRES and ATOM records:

>d1eo6b_ d.15.1.3 (B:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]}
mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf

Timeline for d1eo6b_:

• d1eo6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1eo6b_ appears in SCOPe 2.06
  
• d1eo6b_ appears in the current release, SCOPe 2.08