![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein Golgi-associated ATPase enhancer of 16 kD, Gate-16 [54254] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54255] (1 PDB entry) |
![]() | Domain d1eo6b_: 1eo6 B: [37610] |
PDB Entry: 1eo6 (more details), 1.8 Å
SCOPe Domain Sequences for d1eo6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo6b_ d.15.1.3 (B:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf
Timeline for d1eo6b_: