Lineage for d1h8ca_ (1h8c A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) 
Family d.15.1.2: UBX domain [54250] (5 proteins)
Pfam PF00789
Protein Fas-associated factor 1, Faf1 [54251] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54252] (1 PDB entry) 
Domain d1h8ca_: 1h8c A: [37608]
Details for d1h8ca_
PDB Entry: 1h8c (more details)
PDB Description: ubx domain from human faf1
PDB Compounds: (A:) fas-associated factor 1SCOP Domain Sequences for d1h8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]}
naepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqld
pnksllevklfpqetlfleake
SCOP Domain Coordinates for d1h8ca_:
Click to download the PDB-style file with coordinates for d1h8ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8ca_:
- d1h8ca_ first appeared (with stable ids) in SCOP 1.55
- d1h8ca_ appears in SCOP 1.73
- d1h8ca_ appears in SCOPe 2.01
- d1h8ca_ appears in the current release, SCOPe 2.08
View in 3D