![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.2: UBX domain [54250] (3 proteins) Pfam 00789 |
![]() | Protein Fas-associated factor 1, Faf1 [54251] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54252] (1 PDB entry) |
![]() | Domain d1h8ca_: 1h8c A: [37608] |
PDB Entry: 1h8c (more details)
SCOP Domain Sequences for d1h8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens)} naepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqld pnksllevklfpqetlfleake
Timeline for d1h8ca_: