Lineage for d1h8ca_ (1h8c A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598635Family d.15.1.2: UBX domain [54250] (3 proteins)
    Pfam 00789
  6. 598636Protein Fas-associated factor 1, Faf1 [54251] (1 species)
  7. 598637Species Human (Homo sapiens) [TaxId:9606] [54252] (1 PDB entry)
  8. 598638Domain d1h8ca_: 1h8c A: [37608]

Details for d1h8ca_

PDB Entry: 1h8c (more details)

PDB Description: ubx domain from human faf1

SCOP Domain Sequences for d1h8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens)}
naepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqld
pnksllevklfpqetlfleake

SCOP Domain Coordinates for d1h8ca_:

Click to download the PDB-style file with coordinates for d1h8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ca_: