Lineage for d1vcbd_ (1vcb D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892571Protein Elongin B [54246] (2 species)
  7. 1892572Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)
  8. 1892633Domain d1vcbd_: 1vcb D: [37604]
    Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_

Details for d1vcbd_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (D:) protein (elongin b)

SCOPe Domain Sequences for d1vcbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe

SCOPe Domain Coordinates for d1vcbd_:

Click to download the PDB-style file with coordinates for d1vcbd_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbd_: