Lineage for d1a5ra_ (1a5r A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717170Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 717176Species Human (Homo sapiens) [TaxId:9606] [54242] (13 PDB entries)
  8. 717192Domain d1a5ra_: 1a5r A: [37597]

Details for d1a5ra_

PDB Entry: 1a5r (more details)

PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures
PDB Compounds: (A:) sumo-1

SCOP Domain Sequences for d1a5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ra_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

SCOP Domain Coordinates for d1a5ra_:

Click to download the PDB-style file with coordinates for d1a5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1a5ra_: