Lineage for d1a5r__ (1a5r -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.1: Ubiquitin-like [54236] (5 families) 
Family d.15.1.1: Ubiquitin-related [54237] (5 proteins) Protein SUMO-1 (smt3 homologue) [54241] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [54242] (1 PDB entry) 
Domain d1a5r__: 1a5r - [37597]
Details for d1a5r__
PDB Entry: 1a5r (more details)
PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures
SCOP Domain Sequences for d1a5r__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5r__ d.15.1.1 (-) SUMO-1 (smt3 homologue) {Human (Homo sapiens)}
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
SCOP Domain Coordinates for d1a5r__:
Click to download the PDB-style file with coordinates for d1a5r__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a5r__:
- d1a5r__ first appeared (with stable ids) in SCOP 1.55
- d1a5r__ appears in SCOP 1.59
- d1a5r__ appears in the current release, SCOPe 2.08, called d1a5ra1
View in 3D