Lineage for d6a2bb_ (6a2b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754037Species African clawed frog (Xenopus laevis) [TaxId:8355] [375964] (1 PDB entry)
  8. 2754039Domain d6a2bb_: 6a2b B: [375965]
    Other proteins in same PDB: d6a2ba1
    automated match to d3gbla_

Details for d6a2bb_

PDB Entry: 6a2b (more details), 2.8 Å

PDB Description: crystal structure of xenopus laevis mhc i complex
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d6a2bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a2bb_ b.1.1.0 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
isppvvkvytaepvdfgktnevicyvynyhpprlemrlekngveipdckqtdpsfqhnwk
yyttksthvhidkgdkvecvvshngnpskkyrld

SCOPe Domain Coordinates for d6a2bb_:

Click to download the PDB-style file with coordinates for d6a2bb_.
(The format of our PDB-style files is described here.)

Timeline for d6a2bb_: