Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [375964] (1 PDB entry) |
Domain d6a2bb_: 6a2b B: [375965] Other proteins in same PDB: d6a2ba1 automated match to d3gbla_ |
PDB Entry: 6a2b (more details), 2.8 Å
SCOPe Domain Sequences for d6a2bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a2bb_ b.1.1.0 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} isppvvkvytaepvdfgktnevicyvynyhpprlemrlekngveipdckqtdpsfqhnwk yyttksthvhidkgdkvecvvshngnpskkyrld
Timeline for d6a2bb_: